Skip to Content

ELISA Recombinant Saccharomyces cerevisiae High osmolarity signaling protein SHO1(SHO1)

https://www.anagnostics.com/web/image/product.template/154348/image_1920?unique=e16ca1f
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Saccharomyces cerevisiae (strain Lalvin QA23) (Baker's yeast) Uniprot NO.:E7KMS3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSISSKIRPTPRKPSRMATDHSFKMKNFYADPFAISSISLAIVSWVIAIGGSISSASTNE SFPRFTWWGIVYQFLIICSLmLFYCFDLVDHYRIFITTSIAVAFVYNTNSATNLVYADGP KKAAASAGVILLSIINLIWILYYGGDNASPTNRWIDSFSIKGIRPSPLENSLHRARRRGN RNTTPYQNNVYNDAIRDSGYATQFDGYPQQQPSHTNYVSSTALAGFENTQPNTSEAVNLH LNTLQQRINSASNAKETNDNSNNQTNTNIGNTFDTDFSNGNTETTMGDTLGLYSDIGDDN FIYKAKALYPYDADDDDAYEISFEQNEILQVSDIEGRWWKARRANGETGIIPSNYVQLID GPEEMHR Protein Names:Recommended name: High osmolarity signaling protein SHO1 Alternative name(s): Osmosensor SHO1 Suppressor of SUA8-1 mutation Synthetic high osmolarity-sensitive protein 1 Gene Names:Name:SHO1 Synonyms:SSU81 ORF Names:QA23_1388 Expression Region:1-367 Sequence Info:fµLl length protein

1,722.00 € 1722.0 EUR 1,722.00 €

1,722.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.