Skip to Content

ELISA Recombinant Trichophyton verrucosum Bifunctional lycopene cyclase-phytoene synthase (TRV_03236)

https://www.anagnostics.com/web/image/product.template/160200/image_1920?unique=b3f4f0f
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Trichophyton verrucosum (strain HKI 0517) Uniprot NO.:D4D802 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGLDYLMVHVKYNIPPALLLTILYKPFFTRLEVYKIVFLCTIAVVWTTPWDSYLIRTRVW SYPADSVIGHTIFRIPLEEAFFFIIQTYNTSLIYILFNKRLILLPYLSGPIKPLTQGLFG TVALRTWRDFGILFFTGISVLGISCIRAGGEYMYLGLILSWISPILLLQWPLMYRFLLGL PPASLWVPIVLPTLYLWIVDTLALRRGTWVIESGTKVDIQLWDGLELEEALFFLVTNVMI VLGIAGMDNAIALFEYKAFVSTTAVGETPSIPRLLTLFFTRSRRYCDTNVLREMSQAVTL LKQKSQTMYLGSAMFEGQLRLDLVALYSFCRKADDLIDDAPNRATAQYWIKQCEKALELR FKLKGAALDNTAAYQQLTKSIPPQLHAAVHLLPASRLPKGPLSDLLKGFEIDMKFDSERG IFPIATEHDLEVYAYHVAGTIATLLLELVFRHHPVSISDSERLRVISAGEGMGRALQYTN IARDIVRDAEIGRVYIPSVWLAEQGLTPSMVVNQPRNPKLIPLRRRLLDKAEKCYRDTQE AISELPANVRAPVRATVTVYMDIGQVIRENEMKVWNGKLKVSRWRRFKGAWLAMS Protein Names:Recommended name: Bifunctional lycopene cyclase/phytoene synthase Including the following 2 domains: Lycopene beta-cyclase EC= 5.5.1.19 Alternative name(s): Lycopene cyclase Phytoene synthase EC= 2.5.1.32 Gene Names:ORF Names:TRV_03236 Expression Region:1-595 Sequence Info:fµLl length protein

1,963.00 € 1963.0 EUR 1,963.00 €

1,963.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.