ELISA Recombinant Schizophyllum commune High osmolarity signaling protein SHO1(SHO1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Schizophyllum commune (strain H4-8 / FGSC 9210) (Split gill fungus) Uniprot NO.:D8PSG0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MPPRGNEGLDFTPIITHYLFLFTSILAFIAWFTAFIGQIIATARWNGPVGTLWFAIFLHL FLILGVLYTLASDSLATHRFQISVFGAVALVFAVNGANAGLYAEDGALNAMAAGYLILAI VDILWLLFFTAEEESLLFHLFNRLGTGGLTPPSRRRRARSVHNMAPANGYASGGYGAGGG ISSHDVATGAYDAKPVSGAFDARSGTASGAFDNKSAGAGAGLNSPGGGARSQHSLGGPTT ATGSVHSPRGEDGTGSPLMAQGDMSGAGTSGEFLPKAKALYAYTASPDDPNEISFAKGEI LEVTDKSGKWWSARKADGTNGIAPSNYLQLL Protein Names:Recommended name: High osmolarity signaling protein SHO1 Alternative name(s): Osmosensor SHO1 Gene Names:Name:SHO1 ORF Names:SCHCODRAFT_13733 Expression Region:1-331 Sequence Info:fµLl length protein