ELISA Recombinant Treponema pallidum Motility protein A(motA)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Treponema pallidum (strain Nichols) Uniprot NO.:O07886 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDIASFIGLFGGFAIIIFGAVLGGSARGLFHVPSLLITVGGSYLTLFLTYPLSYAVGVFR VIARVFHAADFHEREIVQRLYALAEKSRRTGLLALEEEIQDFDDDFVRTGLRNVVDGVDG DAIKALMESELTHMEDRHNTWISLLNSWAALAPGYGmLGTVMGLIGmLATLEDKSSLGSN MATALITTFYGSLVQNWFITPVATKLQYQHDLEVKSKEMVIEGVLSIQAGDHPRVLAQRL LTYLSPKMRKELEMELIKD Protein Names:Recommended name: Motility protein A Alternative name(s): Chemotaxis protein MotA Gene Names:Name:motA Ordered Locus Names:TP_0725 Expression Region:1-259 Sequence Info:fµLl length protein