ELISA Recombinant Rhodobacter capsulatus Cobalamin biosynthesis protein CobD(cobD)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rhodobacter capsµLatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) Uniprot NO.:D5AV16 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNFAAMMVVAIGIDLALGWPDALYKRIGHPVTWIGALIARLEKGWNFKGRLRRLRGVLVA LAVIGTTVVIALAVQLWLPAGWPGVLIGGILAWPFVALRSMHDHVAAVAKPLIAGDLPGA RQAVSMIVGRDPSQLDQPGVARAALESLAENSSDGIVAPLFWGCVAGLPGIAGYKAINTL DSMIGHRTDRYEEFGWASARIDDLVNLIPARLTGLFFALASPCRARALAVMARDARSHRS PNAGWPEAAMAGALAVRLSGPRIYADRVANEPWLNGTAPDPRPADLARGLALYRRAMAGM TLVIGLVAVLWSVS Protein Names:Recommended name: Cobalamin biosynthesis protein CobD Gene Names:Name:cobD Synonyms:bluD Ordered Locus Names:RCAP_rcc02054 Expression Region:1-314 Sequence Info:fµLl length protein