ELISA Recombinant Pyrenophora teres f. teres Signal peptidase complex catalytic subunit sec11(sec11)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Pyrenophora teres f. teres (strain 0-1) (Barley net blotch fungus) (Drechslera teres f. teres)
Uniprot NO.:E3RR70
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:mLGIADMQPRQLAAQVLNFALVLSTAFMMWKGLSAASDSPSPIVVVLSGSMEPAFQRGDL LFLWNRGADTQVGEIVVYNVKGKDIPIVHRVVRRYGGGKTPLRLLTKGDNNLADDTELYA AGQSFLNRQEDVIGSVVGFIPFVGYVTILLSEHPWLKQVmLGMMGVMVVLQRE
Protein Names:Recommended name: Signal peptidase complex catalytic subunit sec11 EC= 3.4.21.89 Alternative name(s): Signal peptidase I
Gene Names:Name:sec11 ORF Names:PTT_11281
Expression Region:1-173
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.