ELISA Recombinant Schizosaccharomyces pombe Uncharacterized TLC domain-containing protein C17A2.02c (SPAC17A2.02c)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) Uniprot NO.:O13752 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSSAVTPSDQGLLPRGPIALEEFVKPFCDRFGLTKLPRHMHVILLSALFYQIINILSPVI SRHLSTHYAKLSKKTRLNWDAHVVSSVQSIVLICLGYTCLKEVNAFPDKLFGYSVVAGDI YALTAGYFVWDLYITVRYVHITGIGFVIHAIAALFVITFSYRPYLMYYGPTYLSWELSTP FLNIHYFLDKTNRTGSKFQMINGFILIVTFICVRIAWGWFSAYSTAIEILNHINVAPWAL SLFYLAANMSLNCLNLFWVSKMIDAIRRRAHGEKKSTPLQVTSEYAKKNI Protein Names:Recommended name: Uncharacterized TLC domain-containing protein C17A2.02c Gene Names:ORF Names:SPAC17A2.02c Expression Region:1-290 Sequence Info:fµLl length protein