ELISA Recombinant Schizosaccharomyces pombe Inositol phoshorylceramide synthase regulatory subunit kei1(kei1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) Uniprot NO.:O13994 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MALFRRPNWSALFEKIFIQKSFLGFCSLRVGCEIIIWFAIINKVSGLYGIVSLFQNSDAS PWQVLMYVSSVLmLILFSWLAIHIPKSSVPHALILFYVYLIDFLLNVLFTVLFALSWFSK LVQSDSSSTEESADSDPSPSLLYLFFQAESIPSLLLLIFFASLKFYFVLITLSYSNKLIV DSGIRPQNLPPNFSGRVTRLLMKPYIMAANRSYLRNHTKRFTDSIELEQRLMDEVV Protein Names:Recommended name: Inositol phoshorylceramide synthase regµLatory subunit kei1 Short name= ICP synthase regµLatory subunit kei1 Gene Names:Name:kei1 ORF Names:SPAC26H5.13c Expression Region:1-236 Sequence Info:fµLl length protein