ELISA Recombinant Schizosaccharomyces pombe Putative uncharacterized protein C9E9.01 (SPAC9E9.01)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Uniprot NO.:O14287
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MADGLELSAELSVHTGTVTHTIFVYVFLGKSKRLKTFSDSNVGSVIKLEAGFAVWSRCEA ANGEWMEADNEDRCRLYQIYRESKLKEFARYNVLSRVNW
Protein Names:Recommended name: Putative uncharacterized protein C9E9.01
Gene Names:ORF Names:SPAC9E9.01
Expression Region:1-99
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.