ELISA Recombinant Schizosaccharomyces pombe Protein pdh1(pdh1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) Uniprot NO.:O42826 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:ISIYIKVFGRSSIVTFFLLCFHLVPNALFLFPWTIITTSFVDANVFTLLSSILILSVYGV EIERSWGHKEYLLFCQFLTVIPNIAVLIPCFIAYKITDSHYLLVAIIQSTTAIQAGILTA WYQLYSCKKEESSNKFLCPLSKYLIYLFLSIHLFYVFQSFPWTYFCLAVSGTCISELYVL FVHPVVQELFHLESHTQLPI Protein Names:Recommended name: Protein pdh1 Gene Names:Name:pdh1 ORF Names:SPCC1235.08c Expression Region:27-226 Sequence Info:fµLl length protein