ELISA Recombinant Selaginella moellendorffii CASP-like protein SELMODRAFT_75865 (SELMODRAFT_75865)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Selaginella moellendorffii (Spikemoss) Uniprot NO.:D8QNV6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGAYDGAEAPRAAPASTAANSRPSRLLLLHSLLLRLVAVVVSILVIAVMVHAKQRVMIFK AEWDNSKAFVALVAISAICLGYSFLQFILSAFHLCSKSWKSPTKCWAWMNFIADQILTYA mLGAAAAAAELAYIAKNGSSRAQWQPICSTFNTFCTRAGASIILSFIAVLALANSSAISA YHLFRRPSSSV Protein Names:Recommended name: CASP-like protein SELMODRAFT_75865 Gene Names:ORF Names:SELMODRAFT_75865 Expression Region:1-191 Sequence Info:fµLl length protein