ELISA Recombinant Thermosediminibacter oceani Cobalt transport protein CbiM(cbiM)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Thermosediminibacter oceani (strain ATCC BAA-1034 / DSM 16646 / JW/IW-1228P)
Uniprot NO.:D9S0S1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MHVMEGFLPFKWCLLWYSIYIPFLMAGLIYIKKNIAEEPSKKILLGFAGAFVFALSALKL PSVAGSSSHPTGIGLGAILLGPLPMAVIGGIVLLFQALLLAHGGITTLGANAFSMAVAGS FAAYGLYKVAGRVGLSKSASVFLGAASGDLMTYIITSLQLALAFPASRGGVAASFAGFSG IFAVTQLPLAIGEGILTVIVLNLLEIHAGVVVGRLVKGASNDEG
Protein Names:Recommended name: Cobalt transport protein CbiM Alternative name(s): Energy-coupling factor transporter probable substrate-capture protein CbiM Short name= ECF transporter S component CbiM
Gene Names:Name:cbiM Ordered Locus Names:Toce_0304
Expression Region:21-244
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.