ELISA Recombinant Yersinia enterocolitica subsp. palearctica serotype O:3 L-alanine exporter AlaE(alaE)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Yersinia enterocolitica subsp. palearctica serotype O:3 (strain DSM 13030 / CIP 106945 / Y11) Uniprot NO.:E7B4A5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTMFSTRSRLRSAAADTFALVVYCFVIGMIIEIVISGMTFQQSLSSRLVSIPVNILIAWP YGLYRDAFIRFARRHAGEHMWARNLADLLAYVSFQSPVYALILWSVGADLEQITTAVASN ALVSMAMGVAYGYFLEYCRKLFRVAGYI Protein Names:Recommended name: L-alanine exporter AlaE Gene Names:Name:alaE Ordered Locus Names:Y11_38941 Expression Region:1-148 Sequence Info:fµLl length protein