ELISA Recombinant Rhodobacter sphaeroides Nitric oxide reductase subunit C(norC)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) Uniprot NO.:O06844 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:SEILTKSRARNVFYGGSLFFIAVFVGLTVQSHNYVVSTTPALTDEVILGKHVWERNSCIN CHTLHGEGAYFAPEVGNVMTRWGVLDDPDAAAEmLGGWMDAQPSGVEGRRQMPHFELTDE EKRGLSEFLRWADQMNTQSWPPNDAG Protein Names:Recommended name: Nitric oxide reductase subunit C Alternative name(s): NOR small subunit Nitric oxide reductase cytochrome c subunit Gene Names:Name:norC Ordered Locus Names:Rsph17025_0970 Expression Region:2-147 Sequence Info:fµLl length protein