ELISA Recombinant Schizosaccharomyces pombe Ceramide very long chain fatty acid hydroxylase-like protein C19G12.08 (SPAC19G12.08)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) Uniprot NO.:O13846 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MASVTSEKCVILSDGTEYDVTNYLVANKDAADLLRRYHRQEVADILNATSKSKHSEAVVE ILKSAKVPLKNKEFSDLVDQNIGVGYGNEFIVKPTDLDKDFEKNHFLDLKKPLLPQILFG NIKKDVYLDQVHRPRHYRGSGSAPLFGNFLEPLTKTPWYMIPLIWVPCVTYGFLYACTGI PFSVAITFFIIGLFTWTLVEYTMHRFLFHLDEYTPDHPIFLTMHFAFHGCHHFLPADKYR LVMPPALFLIFATPWYHFIQLVLPHYIGVAGFSGAILGYVFYDLTHYFLHHRRMPNAYLT DLKTWHLDHHYKDYKSAYGITSWFWDRVFGTEGPLFNEQGKISTKAK Protein Names:Recommended name: Ceramide very long chain fatty acid hydroxylase-like protein C19G12.08 EC= 1.-.-.- Gene Names:ORF Names:SPAC19G12.08 Expression Region:1-347 Sequence Info:fµLl length protein