ELISA Recombinant Schizosaccharomyces pombe Probable 3-hydroxyacyl-CoA dehydratase (SPBC19C2.15c, SPBC2F12.16)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) Uniprot NO.:O14346 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSKILKIQYLKLYNVISCFLWMSVLLRTGLIWGITKDTAVVFHETNTLVRWVQTLAIAEV FHSIFGLVSSSPLTTIIQVASRLYLVWGVCYPFSYVIEGSPIYLSMIIAWSITEIIRYAF YAFNLNGDIPAFLTWLRYNTFLILYPIGAGSEFLLVLKSRIAAQYVWSLNKLLWPILMSI YPPGLYIMYTHmLAQRRKISKRAAARRT Protein Names:Recommended name: Probable 3-hydroxyacyl-CoA dehydratase Short name= HACD EC= 4.2.1.- Gene Names:ORF Names:SPBC19C2.15c, SPBC2F12.16 Expression Region:1-208 Sequence Info:fµLl length protein