ELISA Recombinant Rhodobacter sphaeroides Protein translocase subunit SecF(secF)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) Uniprot NO.:O33568 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAFRLKLCPEKTNIDFFWAAPVTFGFSVFLMAASLVAWLTLGLNFGIDFRGGTTIRTEST QAVDVAAYRAALEGQDLGDISITEVFDPGFRADQHVAMVRIGAQDATQSITPEQIGQVEE ALKTVDPSITFPSVESVGPKVSGELIRSAILAVAAACAGIAVYIWLRFEWQFALGSVAAL IHDVLVTIGVFALFQIKFDLTTVAALLTVLGYSINDTVVVFDRLRENLVKYKTMPLRDVM NLSVNETLSRTIMTLMTTLIALVSLLVFGGDVIRGFVFAITFGVVIGTYSSVYMAKNIVL YLGVDRGGPKKDSKAGTQFANIDA Protein Names:Recommended name: Protein translocase subunit SecF Gene Names:Name:secF Ordered Locus Names:RHOS4_03780 ORF Names:RSP_1799 Expression Region:1-324 Sequence Info:fµLl length protein