Skip to Content

ELISA Recombinant Rhodobacter capsulatus Cobalt transport protein CbiQ(cbiQ)

https://www.anagnostics.com/web/image/product.template/153641/image_1920?unique=e16ca1f
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rhodobacter capsµLatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) Uniprot NO.:D5AUZ7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSIASIDRVAAQGRWRNRPLAEKCLIGLGFLALAVTVPPFPGAVLVTVAILAFTFLGARV PLRFWAAVAVLPLGFLTTGAAVLLIQIGPDGIGLAPQGPAKAAALVMRASAATCCLLFLA TTTPAADLLSGLRRWRVPAELIEIALLTYRFVFILAEEAAAMTTAQRARLGHATRRRWLR STAQVIAALLPRALDRARRLETGLAARNWQGEMRVLSTRPAASPLVLGLILTLQAAILAA GVLL Protein Names:Recommended name: Cobalt transport protein CbiQ Alternative name(s): Energy-coupling factor transporter transmembrane protein CbiQ Short name= ECF transporter T component CbiQ Gene Names:Name:cbiQ Synonyms:cbiQ2 Ordered Locus Names:RCAP_rcc02035 Expression Region:1-244 Sequence Info:fµLl length protein

1,593.00 € 1593.0 EUR 1,593.00 €

1,593.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.