ELISA Recombinant Tuber melanosporum Signal peptidase complex catalytic subunit SEC11(SEC11)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Tuber melanosporum (strain Mel28) (Perigord black truffle)
Uniprot NO.:D5GNC3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDALGLSKLRHLKPRQLLSQVLNFALILSTAFmLWKGLSVATDSPSPIVVVLSGSMEPAF QRGDLLFLWNRNLELDSPPTPGTRVGEIVVYNVIGKDIPIVHRVVRKHQGPKTPLHLLTK GDNNHADDTELYARGRWYLDREKEVIGSVVGYVPFVGYVTImLSEHPWMKTALLGIMGLL VIVQRE
Protein Names:Recommended name: Signal peptidase complex catalytic subunit SEC11 EC= 3.4.21.89 Alternative name(s): Signal peptidase I
Gene Names:Name:SEC11 ORF Names:GSTUM_00011219001
Expression Region:1-186
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.