ELISA Recombinant Vibrio cholerae serotype O1 Biopolymer transport protein exbB1(exbB1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) Uniprot NO.:O52043 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MESLQQLQQQLGLMAWPLFICSALTVmLLAERLFQVLLSLTVGKGAIRHALQATSPKNPK QLAELTEHFASKRPVLYRGVAmLLAHHQFDKSLREDAAGIWLQEQRHQFNSGLRLLTLIG VISPLLGLLGTVLGLIEMFKGVAATTGSITPNVLADGLGVAMYTTAAGLLIAVPAVAGAQ LLSLWADRTMAKLEHTLNYVNLWLEGMTLHADASLTVVTPQEATTENL Protein Names:Recommended name: Biopolymer transport protein exbB1 Gene Names:Name:exbB1 Synonyms:exbB Ordered Locus Names:VC_A0911 Expression Region:1-228 Sequence Info:fµLl length protein