ELISA Recombinant Pseudomonas stutzeri Phosphite transport system permease protein ptxC(ptxC)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Pseudomonas stutzeri (Pseudomonas perfectomarina) Uniprot NO.:O69053 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSSHYDVQALPAEQREHILRGFGLGWWRQLGQVAIVFGVVLLACWYVGLLDATTLLNGLP SIATLAGEAMPPDFSGYRSWIRPLIDTLAMSIAGTAIAVVFSLVVAFVAARNTAPHPLVF GVARVLLNALRSVPELIMGIIFVAAVGFGALPGVLALGLHSVGMVGKFFAEAIEHVDEAP VEAARAAGATPMQVLLHAVLPQVTPQFADVAIYRWEYNFRASTVMGMVGAGGIGFELMGS LRIMQYQEVAAILLVILAMVTLVDAFSGVLRKHFK Protein Names:Recommended name: Phosphite transport system permease protein ptxC Gene Names:Name:ptxC Expression Region:1-275 Sequence Info:fµLl length protein