ELISA Recombinant Streptomyces coelicolor Cobalt transport protein CbiN(cbiN)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) Uniprot NO.:O54189 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSRNTRINALLLLAVAALAVLPLVLGLGDHKEEPFAGADAEAETAITEIEPDYEPWFSPL HEPPSGEVESALFALQAALGAGVLAYYFGLRRGRRQGEERASAASGAAAAPGDAPEGD Protein Names:Recommended name: Cobalt transport protein CbiN Alternative name(s): Energy-coupling factor transporter probable substrate-capture protein CbiN Short name= ECF transporter S component CbiN Gene Names:Name:cbiN Ordered Locus Names:SCO5960 ORF Names:SC7H1.30c Expression Region:1-118 Sequence Info:fµLl length protein