ELISA Recombinant Pyrococcus horikoshii Uncharacterized protein PH0614 (PH0614)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) Uniprot NO.:O58348 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:INDNYDLIIVRNDDLIDYLISLPYSHLINAPILPVNPKELDPVTKAQLYSYIQLGRDKVL IIGNTNAVSLDVEKELRDMGFSVTRIGGADRAETAEKLALHFYQNGSKVVILASAWDYGS TLAAAEFAMEYKCPILLTWENQLSPSALRGIEKLNAKIVILVGFGINETIEKTLEGMGYE TYWIGRDIEPPPIETTTSSPPQSSGSKSFFLGMIVTLIILAPVILYLWRRRSERMSEFLE QFNEKELAVLKAIMERGGEVKQEDLPRIVGYSRPTISRIVQDLEKKGIVEREKSGKTFIV RVIKKIKID Protein Names:Recommended name: Uncharacterized protein PH0614 Gene Names:Ordered Locus Names:PH0614 Expression Region:24-332 Sequence Info:fµLl length protein