ELISA Recombinant Pseudomonas stutzeri Putative phosphite transport system permease protein htxE(htxE)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Pseudomonas stutzeri (Pseudomonas perfectomarina) Uniprot NO.:O69064 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MWPPAIAETEEVGRIQDLDRQKLPLFSHIETQERVEQKMNLDTLKMEATTETVEVLVKPV GYVWTVFIKMIETWRLRCGARSCRCWCRFPWRISRPATTSPNRFTYTAARGTISLLRSAP ELIVALFLVLAYGFGPIAGVLALGLHAAGFLGKFYAEDIENADKKPQEALEAIGAGKLKT LWYGVIPQVLPQYIAYTAYILDRNLRMATVIGLVGAGGIGQELKGRFDMFQYGHVMTILI AIFVFVFVLDQLQARIRAKLI Protein Names:Recommended name: Putative phosphite transport system permease protein htxE Gene Names:Name:htxE Expression Region:1-261 Sequence Info:fµLl length protein