ELISA Recombinant Schizosaccharomyces pombe Methylene-fatty-acyl-phospholipid synthase(cho1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) Uniprot NO.:O74827 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSLILYPKPTSYLYQPFIKAYFSLNMAIFEINNSFLICAVSIALNPLLWNIAARSEYNHK TLTKLANGDSKKACYmLAACIFVAGIVRDLIYQNALKQQPTLGIFMNPLVQGIAKLIFCF GSVLVLSSMYKLGLVGTYLGDYFGFLLPERVSGFPFNVNDNPMYNGSTLCFLSTALRYGK VAGLLLTLEVFFVYRIALKFEEPFTAKIYAARDSKQAKKSE Protein Names:Recommended name: Methylene-fatty-acyl-phospholipid synthase EC= 2.1.1.16 Alternative name(s): Unsaturated phospholipid methyltransferase Gene Names:Name:cho1 ORF Names:SPBC337.16 Expression Region:1-221 Sequence Info:fµLl length protein