ELISA Recombinant Schizosaccharomyces pombe Uncharacterized protein wtf10(wtf10)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) Uniprot NO.:O74838 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKNNCTSLKSSIDEEDELKTDHEIDLEKGLLPEYDSKEEGALPLYSDHARLSNSPNTHRE NNPSRSTDNSSPLLIKLLISFTSIILFNAPAVCYLKYKDAFFKNYGAAEWTLFGFWCLVC TLALIFLTYFYETWTKAVKVTVIFLAQCVKACGKGIKHFLKKWENMPMAFSEVFLFNIFG GALRIISRHFFGKRWGLKCSLADHIIFAILSILVFIAETVKPGSIRVNLIRKMGHEAKQQ VNEYTAIPLHEMNPESEA Protein Names:Recommended name: Uncharacterized protein wtf10 Gene Names:Name:wtf10 Synonyms:wtf7 ORF Names:SPCC1183.10 Expression Region:1-258 Sequence Info:fµLl length protein