ELISA Recombinant Schizosaccharomyces pombe Vacuolar ATPase assembly integral membrane protein vph2(vph2)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) Uniprot NO.:O74920 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:mLKELRLHNRNINFLEFLRGVQIVPSDSVFLGEIDENSHTQDNTTTSILKEKELYDGIPL LPSMAGVSMDPEREKKSELRLMKNQISAIINILFTVVGTVTAVWYCTSSLSIEKKIALCA FSAILVLVADTFLYVRYLSAQPVRTSKNHTRQIIYTWTTNDPVLQSNEQLAIELGAIPSL KEKKNQ Protein Names:Recommended name: Vacuolar ATPase assembly integral membrane protein vph2 Gene Names:Name:vph2 ORF Names:SPCC757.10 Expression Region:1-186 Sequence Info:fµLl length protein