ELISA Recombinant Schizosaccharomyces pombe Surfeit locus protein 4 homolog (SPCC970.06)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) Uniprot NO.:O74559 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTSRSPFSTIPLSMNQDSYQTRTTVGIRKKTFSERACQFMEQAETFMAPFTPYMPLLGRF LIVATYFEDAIRIVTQWPEQVSYMRDYRRFRFGTAPLLLFVCVVLmLVGSTLVVFKKRQA YAIGSLLFVTLLQAFAYGLITSGEMFFRNMSVIGGLCLVASDTFIHRRINRFAGLPAVSE HNKRTYFQLAGRVLLIFMFLGLLAKEGSGISWTRILVHILSVTACAMVVIGFKAKFFAAV LVLILSVANFIINSFWSVPRESPYRDFYRYDFFQTLSIVGGLLYLVNTGPGKFSVDEKKK IY Protein Names:Recommended name: Surfeit locus protein 4 homolog Gene Names:ORF Names:SPCC970.06 Expression Region:1-302 Sequence Info:fµLl length protein