ELISA Recombinant Schizosaccharomyces pombe Cytochrome c1, heme protein, mitochondrial(cyt1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) Uniprot NO.:O59680 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:GPSLSAGTPKEEGLHFIQHDWPQSKVLSGFDHASLRRGFQVYREVCSACHSLNLIAWRHL VGVTHTADEAKQMASEVEYEDGPDDEGNMFKRPGKLSDFLPPPYPNVEAARASNNGAAPP DLSCVVRGRHGGQDYIYSLLTGYTEPPAGVEVPDGMNFNPFFPGTQIAMARPLFDDAVEF EDGTPATTAQAAKDVVNFLHWASEPELDIRKKMGFQVITVLTILTALSMWYKRFKWTPIK NRKIFYQRPIK Protein Names:Recommended name: Cytochrome c1, heme protein, mitochondrial Alternative name(s): Complex III subunit 4 Complex III subunit IV Cytochrome b-c1 complex subunit 4 Ubiquinol-cytochrome-c reductase complex cytochrome c1 subunit Short n Gene Names:Name:cyt1 ORF Names:SPBC29A3.18 Expression Region:57-307 Sequence Info:fµLl length protein