ELISA Recombinant Rhizobium meliloti NADH-quinone oxidoreductase subunit A 1(nuoA1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) Uniprot NO.:O68852 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTELLGSYVPIAIFIGIALVIGLALLVAPFAVAFKAPDSEKLSAYECGFNAFDDARMKFD VRFYLVSILFIIFDLEVAFLFPWAVSFKEMGWFGFWSMMVFLLVLTVGFIYEWKKGALEW N Protein Names:Recommended name: NADH-quinone oxidoreductase subunit A 1 EC= 1.6.99.5 Alternative name(s): NADH dehydrogenase I subunit A 1 NDH-1 subunit A 1 NUO1 1 Gene Names:Name:nuoA1 Synonyms:nuoA Ordered Locus Names:R01264 ORF Names:SMc01912 Expression Region:1-121 Sequence Info:fµLl length protein