ELISA Recombinant Rhizobium meliloti NADH-quinone oxidoreductase subunit A 1(nuoA1)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)
Uniprot NO.:O68852
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTELLGSYVPIAIFIGIALVIGLALLVAPFAVAFKAPDSEKLSAYECGFNAFDDARMKFD VRFYLVSILFIIFDLEVAFLFPWAVSFKEMGWFGFWSMMVFLLVLTVGFIYEWKKGALEW N
Protein Names:Recommended name: NADH-quinone oxidoreductase subunit A 1 EC= 1.6.99.5 Alternative name(s): NADH dehydrogenase I subunit A 1 NDH-1 subunit A 1 NUO1 1
Gene Names:Name:nuoA1 Synonyms:nuoA Ordered Locus Names:R01264 ORF Names:SMc01912
Expression Region:1-121
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.