Skip to Content

ELISA Recombinant Trametes versicolor Protein FDD123(FDD123)

https://www.anagnostics.com/web/image/product.template/160089/image_1920?unique=b3f4f0f
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Trametes versicolor (White-rot fungus) (Coriolus versicolor) Uniprot NO.:O74631 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGNSALDLNPPNATFHLSTHGSDWLWAAFSVFGVSLLTVVAWTFTRPRGARLFHQIAIVV LTTGSLAYFSMASDLGATPVPVEFRGEGTRQIWFVRYIQWFITFPLLLLELLLATGLSLS DIFTTLFMSIVLVITGLVAALVPSTYKWGYYTFGVSALFYIWYVLLWHGPHTTFAAGGVL RRGYILAAGYLSFLLLLYPIAWACAEGGNVISVTSEMIWYGILDIFAGPIFLFFFLWELR GVDYATFGLHSGKYTDKSAYAPNTAQAAGTVPATTSTGAAGNV Protein Names:Recommended name: Protein FDD123 Alternative name(s): CvHSP30/1 Gene Names:Name:FDD123 Expression Region:1-283 Sequence Info:fµLl length protein

1,634.00 € 1634.0 EUR 1,634.00 €

1,634.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.