ELISA Recombinant Treponema pallidum Uncharacterized protein TP_0338 (TP_0338)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Treponema pallidum (strain Nichols) Uniprot NO.:O83358 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:EDAARDVEPSDAPVPYEDTEFSLWQKELYRFEALSIGAFPIVTLLSFITYDIIRLIQQWS TKPPTWWALIIPGAELPPLSTKERAIVFGVAVGISVTIGLIDVTYRAVKRAIHRRSLERS QLVPDPIELVPLDSFVEGTDDST Protein Names:Recommended name: Uncharacterized protein TP_0338 Gene Names:Ordered Locus Names:TP_0338 Expression Region:20-162 Sequence Info:fµLl length protein