ELISA Recombinant Schizosaccharomyces pombe Putative uncharacterized membrane protein C622.06c (SPCC622.06c)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) Uniprot NO.:O94596 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSPKESIELQEFQSLLQDEAYEELINKKTYEAIKYRSNDGILPIIITLFIFSFVISRMII FFISLFNKNTYCELPAVADAIINSIALVCIIVILYFSSRKLNVEIRRGEVEDYRANLERN QR Protein Names:Recommended name: Putative uncharacterized membrane protein C622.06c Gene Names:ORF Names:SPCC622.06c Expression Region:1-122 Sequence Info:fµLl length protein