ELISA Recombinant Zea mays Photosystem I reaction center subunit VI, chloroplastic(PSAH)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Zea mays (Maize) Uniprot NO.:O65101 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:YGDKSVYFDLDDIGNTTGQWDLYGSDAPSPYNPLQSKFFETFAAPFTKRGLLLKFLLLGG GSLLAYVSASASPDLLPIKKGPQEPPQPGPRGKI Protein Names:Recommended name: Photosystem I reaction center subunit VI, chloroplastic Short name= PSI-H Alternative name(s): Light-harvesting complex I 11 kDa protein Gene Names:Name:PSAH Expression Region:49-142 Sequence Info:fµLl length protein