ELISA Recombinant Aquifex aeolicus Protein translocase subunit SecF(secF)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Aquifex aeolicus (strain VF5) Uniprot NO.:O67536 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKQIKFLRLRKAAYGVSALLILISLLSLLFRGLNLGLDFTGGTLYEVKFEKSVDIGKLRK TISSAGIKGFLIQETKEGTFVIKVKTGEPVEKLEDVLKKFGKYELIRKETISGVVSEELQ KKAVFAILTALGGILLYLGVRFQPVWGFGAILALAHDVITVLGAYSITQREVNLEVVSAI LVVAGYSVADTVVIFDRIRENLRKKKGFTLEEIMDLSINQTLSRTIMTSLTTLVTALTLF ILGGYALSNIMFAFVVGVVVGTYSSVFVASAFVLDMQKLFKRGEVQTA Protein Names:Recommended name: Protein translocase subunit SecF Gene Names:Name:secF Ordered Locus Names:aq_1602 Expression Region:1-288 Sequence Info:fµLl length protein