ELISA Recombinant Pyrococcus horikoshii Probable ABC transporter permease protein PH1215 (PH1215)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Uniprot NO.:O58968
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MRRSPDLPYIILFLIPALILIGIFVYFAVVWNIYISFTDWRGLIPSYHFVGLAQYKQLIH DPIFWTSLRNNLLLILLFVPGSLLLGLFLAILLDMKVRFESGFRTIYVLPFALSFVVTAT LWAWMYDPSSGVLNVLFDKLGLDFLKSGWITDPKIAMYCIIIALIWQFSGYTMIIYLAGI RSIPIEQYEGALIDGASTWQLYRYIVIPQLTKPTLSAFVVLMVFSLKAFDFIWVLTRGGP GTSTFILAIEMYKETFAKTNFAYGAAIATILLLMALVVVLPYLYWSYKGEER
Protein Names:Recommended name: Probable ABC transporter permease protein PH1215
Gene Names:Ordered Locus Names:PH1215 ORF Names:PHBK039
Expression Region:1-292
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.