ELISA Recombinant Treponema pallidum UPF0073 membrane protein TP_1037 (TP_1037)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Treponema pallidum (strain Nichols)
Uniprot NO.:O84000
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MEKIVNADGSDAICPASAACAKSIRSYQESYSLGEEIANAVTHGIGVGLSIVALVLLVVR AVHYTPADLTARYVVGFSVFGSSLIVLYLCSTLYHALPRGAKYVFGVIDHCCIYVLIAGT YTASCLTTLYGAIGWTVFGVIWGLACSGSVIYSVFGHRVRWLSLVMYIAMGWLVVFVAKP LRERLPEISFLFLVLGGVLYTVGCVFYALKRIKWTHTIWHMFVIGGSVMHFFSLYLSF
Protein Names:Recommended name: UPF0073 membrane protein TP_1037
Gene Names:Ordered Locus Names:TP_1037
Expression Region:1-238
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.