ELISA Recombinant Schizosaccharomyces pombe ER lumen protein retaining receptor(erd2)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) Uniprot NO.:O94270 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTFFSALGDMAHLAAIFLLLHRMKKSKTCSGLSLKSHLLFLLVYVTRYLNLFWRYKSLYY FLMRIVFIASESYICYLmLMTLRPTYDKRLDTFRTEYILGGCAVLALIYPTSYTISNILW TFSIWLESVAILPQLFmLQRSGETESLTAHYLFAMCLYRGLYIPHWIYRIAVHKKVIGVA ILAGIIQTVLYGDFAVVYRRTVLQGKKFRLPA Protein Names:Recommended name: ER lumen protein retaining receptor Gene Names:Name:erd2 ORF Names:SPBP8B7.22 Expression Region:1-212 Sequence Info:fµLl length protein