Skip to Content

ELISA Recombinant Schizosaccharomyces pombe Uncharacterized hydroxylase C887.15c (SPBC887.15c)

https://www.anagnostics.com/web/image/product.template/156384/image_1920?unique=9b59aed
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) Uniprot NO.:O94298 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MVTTVEmLTTWNPVTVSLVSPVIIYWVASAFFGFLHYIELPVFEKYRIHPPEEIARRNRV PQMAVVKAVLFQQLCEVVVGIALAMFEGYPEPIDEAKQmLRYEAFFSKNLPALLQVAPFA PKLAYNFIVPAFQYFFAFFIIDSWQYFWHRYLHYNKKLYNMIHAHHHRLQVPYAMGALYN HPFEGLILDTFGAGVAYLAAGLSPQQAVIFFTLSTLKTVDDHCGYVFPYDPLQMFFANNA RYHDLHHQPYGFQKNFSQPFFTFWDHVLGTYMPPKSETPYEKKQKAKNAKKVN Protein Names:Recommended name: Uncharacterized hydroxylase C887.15c EC= 1.-.-.- Gene Names:ORF Names:SPBC887.15c Expression Region:1-293 Sequence Info:fµLl length protein

1,644.00 € 1644.0 EUR 1,644.00 €

1,644.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.