ELISA Recombinant Zea mays Aquaporin TIP1-1(TIP1-1)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Zea mays (Maize)
Uniprot NO.:O64964
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MPINRIALGSHQEVYHPGALKAAFAEFISTLIFVFAGQGSGMAFSKLTGGGPTTPAGLIA AAVAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLFRGLLYWVAQLLGSTVACFL LRFSTGGQATGTFGLTGVSVWEALVLEIVMTFGLVYTVYATAVDPKKGSLGTIAPIAIGF IVGANILVGGAFDGASMNPAVSFGPALVSWEWGYQWVYWVGPLIGGGLAGVIYELLFISH THEQLPSTDY
Protein Names:Recommended name: Aquaporin TIP1-1 Alternative name(s): Tonoplast intrinsic protein 1-1 ZmTIP1-1 ZmTIP1;1 Short name= ZmTIP1
Gene Names:Name:TIP1-1 Synonyms:TIP1
Expression Region:1-250
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.