ELISA Recombinant Schizosaccharomyces pombe Cytochrome b-c1 complex subunit 9(qcr9)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) Uniprot NO.:O74433 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MASSTIYNIFFRRNSSFYATIFVSAFFAKIGFDVFTDSVWKRANAGLTWDEVKPRFLNKD EDAEDDE Protein Names:Recommended name: Cytochrome b-c1 complex subunit 9 Alternative name(s): Complex III subunit 9 Cytochrome c1 non-heme 7.3 kDa protein Ubiquinol-cytochrome c reductase complex 7.3 kDa protein Gene Names:Name:qcr9 ORF Names:SPCC1682.01 Expression Region:1-67 Sequence Info:fµLl length protein