ELISA Recombinant Schizosaccharomyces pombe Plasma membrane proteolipid 31(pmp31)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) Uniprot NO.:O74837 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSNVTLSDFLLIVLSFFVPFIVVGIRRGFCTADFLINICLCALGIPGIIHAIYIVIKYPR TVRLDIENSPNDPLVRYTPNPEHAVSPHSGPAPPSYSSLASNGMP Protein Names:Recommended name: Plasma membrane proteolipid 31 Alternative name(s): Meiotically up-regµLated gene 75 protein Gene Names:Name:pmp31 Synonyms:mµg75 ORF Names:SPCC1183.09c Expression Region:1-105 Sequence Info:fµLl length protein