ELISA Recombinant Treponema pallidum Uncharacterized protein TP_0070 (TP_0070)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Treponema pallidum (strain Nichols) Uniprot NO.:O83109 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:mLPFYFLSVATNAAIGFILTVLDSQEESAHDCPFLYDATFSLVLALLSGIAAVCKCVNPI GAQLPVLGDLIPTLAGGTGCALFLHRYCVALSKPSPIPRTLVQYAKPLGLFSLAASILHL LFAPTLFL Protein Names:Recommended name: Uncharacterized protein TP_0070 Gene Names:Ordered Locus Names:TP_0070 Expression Region:1-128 Sequence Info:fµLl length protein