ELISA Recombinant Schizosaccharomyces pombe Probable CAAX prenyl protease 2 (SPAC1687.02)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) Uniprot NO.:O94448 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MRVYLISFFFTAIYVVSLYTFPVARPRPSLNRNDPKVITARCISVLLASSVCCILTRLII GPSLNVFTFPTDQVLKSLLHAATIFIGPLYEVWIVDKEYRLFFIHLKDCLSNAIAWRNII IGPLSEELTFRCCIVPICEAAGWSRLKIIFVAPLLFGMAHIHHTYEFLLAYPNAYIAAAL QTVVQFSYTTVFGWYTTHLFLSTHSLFPSFLVHAFCNSMGLPTLYGKIGNRNQTRIYYTL LLLGVLIFYMTWGITDFNNHQDFEPRLVPLN Protein Names:Recommended name: Probable CAAX prenyl protease 2 EC= 3.4.22.- Alternative name(s): Prenyl protein-specific endoprotease 2 Short name= PPSEP 2 Gene Names:ORF Names:SPAC1687.02 Expression Region:1-271 Sequence Info:fµLl length protein