ELISA Recombinant Schizosaccharomyces pombe Meiotically up-regulated gene 150 protein(mug150)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) Uniprot NO.:O94546 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MASLFIIMDKRFAVFASSDKPNNCSRKNMFFLKNIIVLSNYLYLLYKAWIVCTTISLCCD FPLFNFLFIAIPYFTEILYNDSSLLWFLFVSLCFITLSFQSLEI Protein Names:Recommended name: Meiotically up-regµLated gene 150 protein Gene Names:Name:mµg150 ORF Names:SPCC1322.07c Expression Region:1-104 Sequence Info:fµLl length protein