ELISA Recombinant Schizosaccharomyces pombe Putative uncharacterized membrane protein C622.07 (SPCC622.07)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) Uniprot NO.:O94597 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MASLDIHLYVKKDLTYGECVRVAKEKYKIIHRLLYISIIFLFLNYVVDIVCYVKNYNGFS FFCWVFLNLGVIGIIITVIIYYISIPKPDAESEFLNKPDSLNQNVGESQSNEPPKYTSTF MDELDKQD Protein Names:Recommended name: Putative uncharacterized membrane protein C622.07 Gene Names:ORF Names:SPCC622.07 Expression Region:1-128 Sequence Info:fµLl length protein