ELISA Recombinant Xanthomonas campestris pv. campestris Biopolymer transport protein exbB(exbB)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Xanthomonas campestris pv. campestris (strain B100) Uniprot NO.:B0RLE6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:mLQEFVIAAAAGGSNPSAALSQMGFEHLITEMTSSPGDFAVSWVVLITLIAMSAASWYWT VINIFRATRLKSAADRVTTAFWDAPNAQDAIRAMEEQPASEPFSKIALDAAQAAAHHQRA EGSTGGMGESLSRSEFVDRALRQAVTRESTKLQSGMTLLATVGATAPFVGLLGTVWGIYG ALIKIGATGSASIDAVAGPVGEALIMTAIGLFVAIPAVFAFNFFSKVNSSVIAKFDTFAH DLHDFFATGSRVR Protein Names:Recommended name: Biopolymer transport protein exbB Gene Names:Name:exbB Ordered Locus Names:xcc-b100_0009 Expression Region:1-253 Sequence Info:fµLl length protein