ELISA Recombinant Xylella fastidiosa UPF0059 membrane protein Xfasm12_1452 (Xfasm12_1452)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Xylella fastidiosa (strain M12) Uniprot NO.:B0U3E5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSPITILLIGIAMSTDAFAAAIGKGAAIGKPRLRDALYVAVIFGVIETATPIAGWLLGQI ASHYIAAFDHWIAFGLLSGLGIHMIINGLKNNGNTCKDNADTHNRNSRWLTLAATALATS IDAAAIGISLAFLDIHIGIVAAVIGLCTFTMVIFGVmLGRVLGTFVGNRAEIVGGIILII VGSTILYEHLSNTG Protein Names:Recommended name: UPF0059 membrane protein Xfasm12_1452 Gene Names:Ordered Locus Names:Xfasm12_1452 Expression Region:1-194 Sequence Info:fµLl length protein