ELISA Recombinant Ureaplasma parvum serovar 3 UPF0154 protein UPA3_0273 (UPA3_0273)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) Uniprot NO.:B1AIQ4 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNFSSFIFKVSDVFKSVIHEASDVVTKADLDNANAHTHSLAVGLGIGIVLFLIAGLIIGY FISMKIMKRQLKKNPPISKDTIRMIYQQVGRKPSESQINEIYNRAVKQK Protein Names:Recommended name: UPF0154 protein UPA3_0273 Gene Names:Ordered Locus Names:UPA3_0273 Expression Region:1-109 Sequence Info:fµLl length protein