ELISA Recombinant Pseudomonas putida UPF0114 protein PputGB1_0714 (PputGB1_0714)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Pseudomonas putida (strain GB-1) Uniprot NO.:B0KME8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MERILENAMYASRWLLAPIYFGLSLGLLALALKFFQEVVHVLPNVFALSEADLILVILSL IDMSLVGGLLVMVMISGYENFVSQLDIDESKEKLNWLGKMDSSSLKMKVAASIVAISSIH LLRVFMDAQNISTDYLMWYVIIHMTFVISAFCMGYLDKLTKH Protein Names:Recommended name: UPF0114 protein PputGB1_0714 Gene Names:Ordered Locus Names:PputGB1_0714 Expression Region:1-162 Sequence Info:fµLl length protein